CDS

Accession Number TCMCG029C38999
gbkey CDS
Protein Id XP_023742949.1
Location join(38514..38566,38833..38901,38999..39233)
Gene LOC111891096
GeneID 111891096
Organism Lactuca sativa

Protein

Length 118aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA432228
db_source XM_023887181.1
Definition putative coatomer subunit beta'-3 [Lactuca sativa]

EGGNOG-MAPPER Annotation

COG_category U
Description The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko04131        [VIEW IN KEGG]
ko04147        [VIEW IN KEGG]
KEGG_ko ko:K17302        [VIEW IN KEGG]
EC -
KEGG_Pathway -
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005794        [VIEW IN EMBL-EBI]
GO:0005798        [VIEW IN EMBL-EBI]
GO:0006810        [VIEW IN EMBL-EBI]
GO:0006886        [VIEW IN EMBL-EBI]
GO:0006888        [VIEW IN EMBL-EBI]
GO:0006890        [VIEW IN EMBL-EBI]
GO:0006891        [VIEW IN EMBL-EBI]
GO:0008104        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0012506        [VIEW IN EMBL-EBI]
GO:0015031        [VIEW IN EMBL-EBI]
GO:0015833        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0016192        [VIEW IN EMBL-EBI]
GO:0030117        [VIEW IN EMBL-EBI]
GO:0030120        [VIEW IN EMBL-EBI]
GO:0030126        [VIEW IN EMBL-EBI]
GO:0030135        [VIEW IN EMBL-EBI]
GO:0030137        [VIEW IN EMBL-EBI]
GO:0030659        [VIEW IN EMBL-EBI]
GO:0030660        [VIEW IN EMBL-EBI]
GO:0030662        [VIEW IN EMBL-EBI]
GO:0030663        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031410        [VIEW IN EMBL-EBI]
GO:0031982        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033036        [VIEW IN EMBL-EBI]
GO:0034613        [VIEW IN EMBL-EBI]
GO:0042886        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044431        [VIEW IN EMBL-EBI]
GO:0044433        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045184        [VIEW IN EMBL-EBI]
GO:0046907        [VIEW IN EMBL-EBI]
GO:0048193        [VIEW IN EMBL-EBI]
GO:0048475        [VIEW IN EMBL-EBI]
GO:0051179        [VIEW IN EMBL-EBI]
GO:0051234        [VIEW IN EMBL-EBI]
GO:0051641        [VIEW IN EMBL-EBI]
GO:0051649        [VIEW IN EMBL-EBI]
GO:0070727        [VIEW IN EMBL-EBI]
GO:0071702        [VIEW IN EMBL-EBI]
GO:0071705        [VIEW IN EMBL-EBI]
GO:0097708        [VIEW IN EMBL-EBI]
GO:0098588        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098805        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGACAGGTTCAGAAGATGGTACTGTCCGTATATGGCATTCAACCACTTACAGACTTGAGAACACCTTGAACTATGGACTTGAAAGGGTTTGGGCTGTTGGATACATGAAAGGTTCACGTCGGATTGTTATTGGCTATGATGAAGGAACCATAATGGTGAAAATTGGACGTGAAGAGCCTGTAGCCAGCATGGACAATAGTGGAAAAATTATATGGGCTAAACATAATGAAATTCAAACTATTAACATCAAGAGTGTGGGAGCTGATCATGAGGTTTGGACTTTAAAGCCCATATACATGTTATGTTATGTTAACAATGAAATGGGAAAAAAATCTATTTTTTATTCAGGTTTCTGA
Protein:  
MTGSEDGTVRIWHSTTYRLENTLNYGLERVWAVGYMKGSRRIVIGYDEGTIMVKIGREEPVASMDNSGKIIWAKHNEIQTINIKSVGADHEVWTLKPIYMLCYVNNEMGKKSIFYSGF